Lineage for d4hd9a1 (4hd9 A:1-90)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365653Domain d4hd9a1: 4hd9 A:1-90 [222521]
    Other proteins in same PDB: d4hd9a2
    automated match to d1gsma1
    complexed with nag

Details for d4hd9a1

PDB Entry: 4hd9 (more details), 1.7 Å

PDB Description: crystal structure of native human madcam-1 d1d2 domain
PDB Compounds: (A:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hd9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hd9a1 b.1.1.0 (A:1-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
naslsaagtrvcvgscggrtfqhtvqllvy

SCOPe Domain Coordinates for d4hd9a1:

Click to download the PDB-style file with coordinates for d4hd9a1.
(The format of our PDB-style files is described here.)

Timeline for d4hd9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hd9a2