SCOPe 2.07: Domain d4hcrb1: 4hcr B:1-90

Lineage for d4hcrb1 (4hcr B:1-90)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4hcrb1: 4hcr B:1-90 [222515]
   Other proteins in same PDB: d4hcra2, d4hcrb2, d4hcrl2, d4hcrn2
   automated match to d1gsma1

Details for d4hcrb1

PDB Entry: 4hcr, 2.3 Å

PDB Description: crystal structure of human madcam-1 d1d2 complexed with fab pf-547659

PDB Compounds: (B:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hcrb1:

Sequence; same for both SEQRES and ATOM records:

>d4hcrb1 b.1.1.0 (B:1-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
naslsaagtrvcvgscggrtfqhtvqllvy

Timeline for d4hcrb1:

• d4hcrb1 first appeared in SCOPe 2.03
  
• d4hcrb1 appears in SCOPe 2.06
  
• d4hcrb1 appears in the current release, SCOPe 2.08