Lineage for d4hcnb_ (4hcn B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893753Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1893754Protein automated matches [190233] (11 species)
    not a true protein
  7. 1893765Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (5 PDB entries)
  8. 1893770Domain d4hcnb_: 4hcn B: [222506]
    automated match to d3dbhi_
    complexed with fmt, peg, po4

Details for d4hcnb_

PDB Entry: 4hcn (more details), 2.6 Å

PDB Description: crystal structure of burkholderia pseudomallei effector protein chbp in complex with ubiquitin
PDB Compounds: (B:) Polyubiquitin

SCOPe Domain Sequences for d4hcnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hcnb_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pmqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdy
niqkestlhlvlrlrgg

SCOPe Domain Coordinates for d4hcnb_:

Click to download the PDB-style file with coordinates for d4hcnb_.
(The format of our PDB-style files is described here.)

Timeline for d4hcnb_: