SCOPe 2.05: Domain d4hcla1: 4hcl A:-1-126

Lineage for d4hcla1 (4hcl A:-1-126)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226505] (6 PDB entries)

8. Domain d4hcla1: 4hcl A:-1-126 [222502]
   Other proteins in same PDB: d4hcla2, d4hclb2
   automated match to d1rvka2
   complexed with llh, mg, pg4

Details for d4hcla1

PDB Entry: 4hcl, 1.8 Å

PDB Description: crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-lyxarohydroxamate

PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hcla1:

Sequence; same for both SEQRES and ATOM records:

>d4hcla1 d.54.1.0 (A:-1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
pvykligg

Timeline for d4hcla1:

• d4hcla1 first appeared in SCOPe 2.03
  
• d4hcla1 appears in SCOPe 2.04
  
• d4hcla1 appears in SCOPe 2.06
  
• d4hcla1 appears in the current release, SCOPe 2.08