SCOPe 2.06: Domain d4hchb2: 4hch B:127-382

Lineage for d4hchb2 (4hch B:127-382)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (13 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226506] (6 PDB entries)

8. Domain d4hchb2: 4hch B:127-382 [222501]
   Other proteins in same PDB: d4hcha1, d4hcha3, d4hchb1, d4hchb3
   automated match to d1rvka1
   complexed with edo, gol, mg, na, pge, tla

Details for d4hchb2

PDB Entry: 4hch, 1.7 Å

PDB Description: crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-tartrate

PDB Compounds: (B:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hchb2:

Sequence; same for both SEQRES and ATOM records:

>d4hchb2 c.1.11.2 (B:127-382) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswapdvkmd
lkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqslssykwl
sdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlaeafgmec
evhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvhvpdrpg
lgedidftfidnnrvr

Timeline for d4hchb2:

• d4hchb2 first appeared in SCOPe 2.03
  
• d4hchb2 appears in SCOPe 2.05
  
• d4hchb2 appears in SCOPe 2.07
  
• d4hchb2 appears in the current release, SCOPe 2.08