SCOPe 2.04: Domain d4hc1l2: 4hc1 L:108-213

Lineage for d4hc1l2 (4hc1 L:108-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d4hc1l2: 4hc1 L:108-213 [222495]
   Other proteins in same PDB: d4hc1a1, d4hc1a2, d4hc1b1, d4hc1b2, d4hc1l1, d4hc1n1
   automated match to d1c12a2
   complexed with nag; mutant

Details for d4hc1l2

PDB Entry: 4hc1, 2.87 Å

PDB Description: crystal structure of a loop deleted mutant of human madcam-1 d1d2 complexed with fab 10g3

PDB Compounds: (L:) 10G3 light chain

SCOPe Domain Sequences for d4hc1l2:

Sequence; same for both SEQRES and ATOM records:

>d4hc1l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4hc1l2:

• d4hc1l2 first appeared in SCOPe 2.03
  
• d4hc1l2 appears in SCOPe 2.05
  
• d4hc1l2 appears in the current release, SCOPe 2.08