Lineage for d4hc1l1 (4hc1 L:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513189Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)
  8. 1513338Domain d4hc1l1: 4hc1 L:1-107 [222494]
    Other proteins in same PDB: d4hc1a1, d4hc1a2, d4hc1b1, d4hc1b2, d4hc1l2, d4hc1n2
    automated match to d1c12a1
    complexed with nag; mutant

Details for d4hc1l1

PDB Entry: 4hc1 (more details), 2.87 Å

PDB Description: crystal structure of a loop deleted mutant of human madcam-1 d1d2 complexed with fab 10g3
PDB Compounds: (L:) 10G3 light chain

SCOPe Domain Sequences for d4hc1l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hc1l1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsftchasqgigrnigwlqqkpgksfkgliyhgtnlkdgvps
rfsgsgsgadysltisriesedfadyyciqyvqfpytfgggtkleik

SCOPe Domain Coordinates for d4hc1l1:

Click to download the PDB-style file with coordinates for d4hc1l1.
(The format of our PDB-style files is described here.)

Timeline for d4hc1l1: