Lineage for d4hc1a2 (4hc1 A:91-202)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031930Protein automated matches [190803] (2 species)
    not a true protein
  7. 2031931Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries)
  8. 2031965Domain d4hc1a2: 4hc1 A:91-202 [222491]
    Other proteins in same PDB: d4hc1a1, d4hc1a3, d4hc1b1, d4hc1b3, d4hc1l1, d4hc1l2, d4hc1n1, d4hc1n2
    automated match to d1bqsa2
    complexed with nag; mutant

Details for d4hc1a2

PDB Entry: 4hc1 (more details), 2.87 Å

PDB Description: crystal structure of a loop deleted mutant of human madcam-1 d1d2 complexed with fab 10g3
PDB Compounds: (A:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hc1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hc1a2 b.1.1.4 (A:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqqep
iggdvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl

SCOPe Domain Coordinates for d4hc1a2:

Click to download the PDB-style file with coordinates for d4hc1a2.
(The format of our PDB-style files is described here.)

Timeline for d4hc1a2: