SCOPe 2.05: Domain d4hbld_: 4hbl D:

Lineage for d4hbld_ (4hbl D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:176279] [226549] (1 PDB entry)

8. Domain d4hbld_: 4hbl D: [222483]
   automated match to d1jgsa_

Details for d4hbld_

PDB Entry: 4hbl, 2.5 Å

PDB Description: Crystal structure of AbfR of Staphylococcus epidermidis

PDB Compounds: (D:) transcriptional regulator, MarR family

SCOPe Domain Sequences for d4hbld_:

Sequence; same for both SEQRES and ATOM records:

>d4hbld_ a.4.5.0 (D:) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsig
rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
efdtteydetkyvfeeleqtlkhliek

Timeline for d4hbld_:

• d4hbld_ first appeared in SCOPe 2.03
  
• d4hbld_ appears in SCOPe 2.04
  
• d4hbld_ is called d4hbld1 in SCOPe 2.06
  
• d4hbld_ appears in the current release, SCOPe 2.08, called d4hbld1