SCOP 1.61: Domain d1azvb_: 1azv B:

Lineage for d1azvb_ (1azv B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (8 PDB entries)

8. Domain d1azvb_: 1azv B: [22248]

Details for d1azvb_

PDB Entry: 1azv, 1.9 Å

PDB Description: familial als mutant g37r cuznsod (human)

SCOP Domain Sequences for d1azvb_:

Sequence; same for both SEQRES and ATOM records:

>d1azvb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikrlteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Timeline for d1azvb_:

• d1azvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1azvb_ appears in SCOP 1.59
  
• d1azvb_ appears in SCOP 1.63
  
• d1azvb_ appears in the current release, SCOPe 2.08