SCOPe 2.06: Domain d4hb4a_: 4hb4 A:

Lineage for d4hb4a_ (4hb4 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (43 PDB entries)

8. Domain d4hb4a_: 4hb4 A: [222475]
   Other proteins in same PDB: d4hb4b_
   automated match to d4hb3a_
   complexed with cl, edo, gnp, gol, lmb, mg

Details for d4hb4a_

PDB Entry: 4hb4, 2.05 Å

PDB Description: crystal structure of crm1 inhibitor leptomycin b in complex with crm1(537dltvk541/glceq)-ran-ranbp1

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d4hb4a_:

Sequence; same for both SEQRES and ATOM records:

>d4hb4a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpdedddl

Timeline for d4hb4a_:

• d4hb4a_ first appeared in SCOPe 2.03
  
• d4hb4a_ appears in SCOPe 2.05
  
• d4hb4a_ appears in SCOPe 2.07
  
• d4hb4a_ appears in the current release, SCOPe 2.08