Lineage for d4hb2a_ (4hb2 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124942Protein Ran [52609] (2 species)
  7. 2124974Species Human (Homo sapiens) [TaxId:9606] [52611] (43 PDB entries)
  8. 2124976Domain d4hb2a_: 4hb2 A: [222473]
    Other proteins in same PDB: d4hb2b_
    automated match to d4hb3a_
    complexed with cl, edo, gnp, gol, mg

Details for d4hb2a_

PDB Entry: 4hb2 (more details), 1.8 Å

PDB Description: crystal structure of crm1-ran-ranbp1
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d4hb2a_:

Sequence, based on SEQRES records: (download)

>d4hb2a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
mdpalaaqyehdlevaqttalpdedddl

Sequence, based on observed residues (ATOM records): (download)

>d4hb2a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
laaqyehdlevaqttalpdedddl

SCOPe Domain Coordinates for d4hb2a_:

Click to download the PDB-style file with coordinates for d4hb2a_.
(The format of our PDB-style files is described here.)

Timeline for d4hb2a_: