Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (5 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (21 PDB entries) |
Domain d4hb0b_: 4hb0 B: [222472] Other proteins in same PDB: d4hb0a_ automated match to d4hb3b_ complexed with cl, gnp, lbf, mg |
PDB Entry: 4hb0 (more details), 2.2 Å
SCOPe Domain Sequences for d4hb0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hb0b_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eedeevlykvraklfrfdkdakewkergtgdckflknkktnkvrilmrrdktlkicanhi iapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeink k
Timeline for d4hb0b_: