Lineage for d1azva_ (1azv A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) Species Human (Homo sapiens) [TaxId:9606] [49333] (7 PDB entries) 
Domain d1azva_: 1azv A: [22247]
Details for d1azva_
PDB Entry: 1azv (more details), 1.9 Å
PDB Description: familial als mutant g37r cuznsod (human)
SCOP Domain Sequences for d1azva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azva_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikrlteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq
SCOP Domain Coordinates for d1azva_:
Click to download the PDB-style file with coordinates for d1azva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1azva_:
- d1azva_ appears in SCOP 1.57
- d1azva_ appears in the current release, SCOPe 2.08
View in 3D
