Lineage for d4haxa_ (4hax A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595107Protein Ran [52609] (2 species)
  7. 1595127Species Human (Homo sapiens) [TaxId:9606] [52611] (29 PDB entries)
  8. 1595146Domain d4haxa_: 4hax A: [222465]
    Other proteins in same PDB: d4haxb_
    automated match to d4hb3a_
    complexed with cl, edo, gnp, gol, mg, rja

Details for d4haxa_

PDB Entry: 4hax (more details), 2.28 Å

PDB Description: crystal structure of crm1 inhibitor ratjadone a in complex with crm1(k579a)-ran-ranbp1
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d4haxa_:

Sequence, based on SEQRES records: (download)

>d4haxa_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpdedddl

Sequence, based on observed residues (ATOM records): (download)

>d4haxa_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappeq
yehdlevaqttalpdedddl

SCOPe Domain Coordinates for d4haxa_:

Click to download the PDB-style file with coordinates for d4haxa_.
(The format of our PDB-style files is described here.)

Timeline for d4haxa_: