Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (31 PDB entries) |
Domain d4havb_: 4hav B: [222462] Other proteins in same PDB: d4hava_ automated match to d4hb3b_ complexed with aa8, cl, gnp, mg |
PDB Entry: 4hav (more details), 2 Å
SCOPe Domain Sequences for d4havb_:
Sequence, based on SEQRES records: (download)
>d4havb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ihfepvvhlekvdvktmeedeevlykvraklfrfdkdakewkergtgdckflknkktnkv rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske nadkfkeefekaqeinkk
>d4havb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ihfepvvktmeedeevlykvraklfrfdkdakewkergtgdckflknkktnkvrilmrrd ktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfke efekaqeinkk
Timeline for d4havb_: