Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Leishmania major [TaxId:347515] [226496] (2 PDB entries) |
Domain d4h7pb2: 4h7p B:156-324 [222424] Other proteins in same PDB: d4h7pa1, d4h7pb1 automated match to d1civa2 complexed with so4 |
PDB Entry: 4h7p (more details), 1.3 Å
SCOPe Domain Sequences for d4h7pb2:
Sequence, based on SEQRES records: (download)
>d4h7pb2 d.162.1.0 (B:156-324) automated matches {Leishmania major [TaxId: 347515]} trldhnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpareaikddald ddfvqvvrgrgaeiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygv psglifsfpctchagewtvvsgklngdlgkqrlastiaelqeeraqagl
>d4h7pb2 d.162.1.0 (B:156-324) automated matches {Leishmania major [TaxId: 347515]} trldhnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpdfvqvvrgrga eiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygvpsglifsfpctc hagewtvvsgklkqrlastiaelqeeraqagl
Timeline for d4h7pb2: