Lineage for d4h7pa2 (4h7p A:156-324)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233243Species Leishmania major [TaxId:347515] [226496] (2 PDB entries)
  8. 2233244Domain d4h7pa2: 4h7p A:156-324 [222422]
    Other proteins in same PDB: d4h7pa1, d4h7pb1
    automated match to d1civa2
    complexed with so4

Details for d4h7pa2

PDB Entry: 4h7p (more details), 1.3 Å

PDB Description: Crystal structure of a putative Cytosolic malate dehydrogenase from Leishmania major Friedlin
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4h7pa2:

Sequence, based on SEQRES records: (download)

>d4h7pa2 d.162.1.0 (A:156-324) automated matches {Leishmania major [TaxId: 347515]}
trldhnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpareaikddald
ddfvqvvrgrgaeiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygv
psglifsfpctchagewtvvsgklngdlgkqrlastiaelqeeraqagl

Sequence, based on observed residues (ATOM records): (download)

>d4h7pa2 d.162.1.0 (A:156-324) automated matches {Leishmania major [TaxId: 347515]}
trldhnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpareaikdfvqv
vrgrgaeiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygvpsglif
sfpctchagewtvvsgklkqrlastiaelqeeraqagl

SCOPe Domain Coordinates for d4h7pa2:

Click to download the PDB-style file with coordinates for d4h7pa2.
(The format of our PDB-style files is described here.)

Timeline for d4h7pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h7pa1