SCOPe 2.08: Domain d4h7pa1: 4h7p A:1-155

Lineage for d4h7pa1 (4h7p A:1-155)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Leishmania major [TaxId:347515] [226495] (2 PDB entries)

8. Domain d4h7pa1: 4h7p A:1-155 [222421]
   Other proteins in same PDB: d4h7pa2, d4h7pb2
   automated match to d1civa1
   complexed with so4

Details for d4h7pa1

PDB Entry: 4h7p, 1.3 Å

PDB Description: Crystal structure of a putative Cytosolic malate dehydrogenase from Leishmania major Friedlin

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4h7pa1:

Sequence; same for both SEQRES and ATOM records:

>d4h7pa1 c.2.1.0 (A:1-155) automated matches {Leishmania major [TaxId: 347515]}
msavkvavtgaagqigyalvpliargallgpttpvelrlldiepalkalagveaeledca
fplldkvvvtadprvafdgvaiaimcgafprkagmerkdllemnarifkeqgeaiaavaa
sdcrvvvvgnpantnalillksaqgklnprhvtam

Timeline for d4h7pa1:

• d4h7pa1 first appeared in SCOPe 2.03
  
• d4h7pa1 appears in SCOPe 2.07