SCOPe 2.05: Domain d4h51b_: 4h51 B:

Lineage for d4h51b_ (4h51 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (98 species)
   not a true protein

7. Species Leishmania major [TaxId:347515] [226494] (1 PDB entry)

8. Domain d4h51b_: 4h51 B: [222388]
   automated match to d7aata_
   complexed with edo

Details for d4h51b_

PDB Entry: 4h51, 1.85 Å

PDB Description: crystal structure of a putative aspartate aminotransferase from leishmania major friedlin

PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d4h51b_:

Sequence; same for both SEQRES and ATOM records:

>d4h51b_ c.67.1.0 (B:) automated matches {Leishmania major [TaxId: 347515]}
mttaerwqkiqaqapdvifdlakraaaakgpkanlvigayrdeqgrpyplrvvrkaeqll
ldmnldyeylpisgyqpfideavkiiygntvelenlvavqtlsgtgavslgaklltrvfd
aettpiylsdptwpnhygvvkaagwknictyayydpktvslnfegmkkdilaapdgsvfi
lhqcahnptgvdpsqeqwneiaslmlakhhqvffdsayqgyasgsldtdayaarlfarrg
ievllaqsfsknmglyseragtlslllkdktkradvksvmdslireeytcppahgarlah
lilsnnelrkeweaelsamaerirtmrrtvydellrlqtpgswehvinqigmfsflglsk
aqceycqnhnifitvsgranmaglthetalmlaqtindavrnv

Timeline for d4h51b_:

• d4h51b_ first appeared in SCOPe 2.03
  
• d4h51b_ appears in SCOPe 2.04
  
• d4h51b_ appears in SCOPe 2.06
  
• d4h51b_ appears in the current release, SCOPe 2.08