SCOPe 2.04: Domain d4h4ma2: 4h4m A:430-548

Lineage for d4h4ma2 (4h4m A:430-548)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (26 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (15 PDB entries)

8. Domain d4h4ma2: 4h4m A:430-548 [222382]
   Other proteins in same PDB: d4h4ma1, d4h4mb_
   automated match to d1bqna1
   complexed with 494, edo

Details for d4h4ma2

PDB Entry: 4h4m, 2.85 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with (e)- 3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)- yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66 RT

SCOPe Domain Sequences for d4h4ma2:

Sequence; same for both SEQRES and ATOM records:

>d4h4ma2 c.55.3.0 (A:430-548) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqv

Timeline for d4h4ma2:

• d4h4ma2 first appeared in SCOPe 2.03
  
• d4h4ma2 appears in SCOPe 2.05
  
• d4h4ma2 appears in the current release, SCOPe 2.08