SCOPe 2.05: Domain d4h4ma1: 4h4m A:1-429

Lineage for d4h4ma1 (4h4m A:1-429)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (5 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [226272] (12 PDB entries)

8. Domain d4h4ma1: 4h4m A:1-429 [222381]
   Other proteins in same PDB: d4h4ma2
   automated match to d1bqna2
   complexed with 494, edo

Details for d4h4ma1

PDB Entry: 4h4m, 2.85 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with (e)- 3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)- yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66 RT

SCOPe Domain Sequences for d4h4ma1:

Sequence; same for both SEQRES and ATOM records:

>d4h4ma1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d4h4ma1:

• d4h4ma1 first appeared in SCOPe 2.03
  
• d4h4ma1 appears in SCOPe 2.04
  
• d4h4ma1 appears in SCOPe 2.06
  
• d4h4ma1 appears in the current release, SCOPe 2.08