Lineage for d4h32g1 (4h32 G:5-323)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047718Domain d4h32g1: 4h32 G:5-323 [222358]
    Other proteins in same PDB: d4h32a2, d4h32b_, d4h32c2, d4h32d_, d4h32e2, d4h32f_, d4h32g2, d4h32h_, d4h32i2, d4h32j_, d4h32k2, d4h32l_
    automated match to d1rd8a_
    complexed with nag

Details for d4h32g1

PDB Entry: 4h32 (more details), 2.7 Å

PDB Description: the crystal structure of the hemagglutinin h17 derived the bat influenza a virus
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d4h32g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h32g1 b.19.1.2 (G:5-323) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlagw
llgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnpq
smtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntkd
aaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlries
tgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtignc
pkyvkatslmlatglrnnp

SCOPe Domain Coordinates for d4h32g1:

Click to download the PDB-style file with coordinates for d4h32g1.
(The format of our PDB-style files is described here.)

Timeline for d4h32g1: