Lineage for d3sodo_ (3sod O:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) 
Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries) 
Domain d3sodo_: 3sod O: [22235]
Details for d3sodo_
PDB Entry: 3sod (more details), 2.1 Å
PDB Description: changes in crystallographic structure and thermostability of a cu,zn superoxide dismutase mutant resulting from the removal of buried cysteine
SCOP Domain Sequences for d3sodo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sodo_ b.1.8.1 (O:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavavlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak
SCOP Domain Coordinates for d3sodo_:
Click to download the PDB-style file with coordinates for d3sodo_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3sodo_:
- d3sodo_ appears in SCOP 1.57
- d3sodo_ appears in the current release, SCOPe 2.08
View in 3D