SCOPe 2.08: Domain d4h2db_: 4h2d B:

Lineage for d4h2db_ (4h2d B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226640] (7 PDB entries)

8. Domain d4h2db_: 4h2d B: [222333]
   automated match to d1bvyf_
   complexed with fmn

Details for d4h2db_

PDB Entry: 4h2d, 1.8 Å

PDB Description: crystal structure of ndor1

PDB Compounds: (B:) NADPH-dependent diflavin oxidoreductase 1

SCOPe Domain Sequences for d4h2db_:

Sequence; same for both SEQRES and ATOM records:

>d4h2db_ c.23.5.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqllvlfgsqtgtaqdvserlgrearrrrlgcrvqaldsypvvnlineplvifvcattgq
gdppdnmknfwrfifrknlpstalcqmdfavlglgdssyakfnfvakklhrrllqlggsa
llpvclgddqhelgpdaavdpwlrdlwdrvlgl

Timeline for d4h2db_:

• d4h2db_ first appeared in SCOPe 2.03
  
• d4h2db_ appears in SCOPe 2.07