Lineage for d4h0vb2 (4h0v B:147-374)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491252Protein Actin [53073] (10 species)
  7. 2491291Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 2491347Domain d4h0vb2: 4h0v B:147-374 [222314]
    Other proteins in same PDB: d4h0va1, d4h0va2
    automated match to d1qz5a2
    complexed with atp, ca, edo, lar, nad, po4

Details for d4h0vb2

PDB Entry: 4h0v (more details), 2.03 Å

PDB Description: Crystal structure of NAD+-Ia(E378S)-actin complex
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4h0vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0vb2 c.55.1.1 (B:147-374) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

SCOPe Domain Coordinates for d4h0vb2:

Click to download the PDB-style file with coordinates for d4h0vb2.
(The format of our PDB-style files is described here.)

Timeline for d4h0vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h0vb1