SCOPe 2.08: Domain d1sxzb_: 1sxz B:

Lineage for d1sxzb_ (1sxz B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)

8. Domain d1sxzb_: 1sxz B: [22230]
   complexed with azi, ca, cu, zn

Details for d1sxzb_

PDB Entry: 1sxz, 2.05 Å

PDB Description: Reduced bovine superoxide dismutase at pH 5.0 complexed with azide

PDB Compounds: (B:) protein (cu-zn superoxide dismutase)

SCOPe Domain Sequences for d1sxzb_:

Sequence; same for both SEQRES and ATOM records:

>d1sxzb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d1sxzb_:

• d1sxzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sxzb_ appears in SCOPe 2.07