SCOPe 2.08: Domain d4h0ga2: 4h0g A:140-251

Lineage for d4h0ga2 (4h0g A:140-251)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4h0ga2: 4h0g A:140-251 [222299]
   automated match to d1dzba2
   complexed with trs

Details for d4h0ga2

PDB Entry: 4h0g, 2.3 Å

PDB Description: Crystal structure of mimicry-recognizing native 2D10 scFv

PDB Compounds: (A:) 2D10 scFv

SCOPe Domain Sequences for d4h0ga2:

Sequence; same for both SEQRES and ATOM records:

>d4h0ga2 b.1.1.0 (A:140-251) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpfslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpytfgggtkleik

Timeline for d4h0ga2:

• d4h0ga2 first appeared in SCOPe 2.03
  
• d4h0ga2 appears in SCOPe 2.07