Lineage for d4h0ga1 (4h0g A:1-120)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766970Domain d4h0ga1: 4h0g A:1-120 [222298]
    automated match to d1dzba1
    complexed with trs

Details for d4h0ga1

PDB Entry: 4h0g (more details), 2.3 Å

PDB Description: Crystal structure of mimicry-recognizing native 2D10 scFv
PDB Compounds: (A:) 2D10 scFv

SCOPe Domain Sequences for d4h0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0ga1 b.1.1.0 (A:1-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
meiqlqqsgpelvkpgasvkisckasgysftdyimlwvkqshgkslewigninpyygsts
ynlkfkgkatltvdkssstaymqlnsltsedsavyycarknyygssldywgqgttltvss

SCOPe Domain Coordinates for d4h0ga1:

Click to download the PDB-style file with coordinates for d4h0ga1.
(The format of our PDB-style files is described here.)

Timeline for d4h0ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h0ga2