SCOPe 2.06: Domain d4h03b1: 4h03 B:5-146

Lineage for d4h03b1 (4h03 B:5-146)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (8 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (63 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d4h03b1: 4h03 B:5-146 [222296]
   Other proteins in same PDB: d4h03a1, d4h03a2, d4h03a3
   automated match to d1qz5a1
   complexed with atp, ca, edo, lar, nad, po4

Details for d4h03b1

PDB Entry: 4h03, 1.75 Å

PDB Description: Crystal structure of NAD+-Ia-actin complex

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4h03b1:

Sequence, based on SEQRES records:

>d4h03b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d4h03b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrkdsyvgdeaqskrgiltlkypiehgii
tnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvai
qavlslyasg

Timeline for d4h03b1:

• d4h03b1 first appeared in SCOPe 2.03
  
• d4h03b1 appears in SCOPe 2.05
  
• d4h03b1 appears in SCOPe 2.07
  
• d4h03b1 appears in the current release, SCOPe 2.08