Lineage for d1e9ob_ (1e9o B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55083Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 55084Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 55097Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 55117Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries)
  8. 55129Domain d1e9ob_: 1e9o B: [22228]

Details for d1e9ob_

PDB Entry: 1e9o (more details), 1.85 Å

PDB Description: crystal structure of bovine sod - 1 of 3

SCOP Domain Sequences for d1e9ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9ob_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdderhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneeststgnagsrlacgvigiak

SCOP Domain Coordinates for d1e9ob_:

Click to download the PDB-style file with coordinates for d1e9ob_.
(The format of our PDB-style files is described here.)

Timeline for d1e9ob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e9oa_