SCOPe 2.04: Domain d4gypb2: 4gyp B:138-446

Lineage for d4gypb2 (4gyp B:138-446)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins)

6. Protein D-glucarate dehydratase [51610] (2 species)

7. Species Escherichia coli [TaxId:562] [51612] (7 PDB entries)

8. Domain d4gypb2: 4gyp B:138-446 [222277]
   Other proteins in same PDB: d4gypa1, d4gypb1, d4gypc1, d4gypc2, d4gypd1, d4gypd2
   automated match to d1ec7d1
   complexed with cit, gol, mg, p6g, peg, so4

Details for d4gypb2

PDB Entry: 4gyp, 2.1 Å

PDB Description: crystal structure of the heterotetrameric complex of glucd and glucdrp from e. coli k-12 mg1655 (efi target efi-506058)

PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d4gypb2:

Sequence; same for both SEQRES and ATOM records:

>d4gypb2 c.1.11.2 (B:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye
kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla
yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw
tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr
ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf
dnkrpcmvr

Timeline for d4gypb2:

• d4gypb2 first appeared in SCOPe 2.03
  
• d4gypb2 appears in SCOPe 2.05
  
• d4gypb2 appears in the current release, SCOPe 2.08