![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein D-glucarate dehydratase [54831] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [54833] (7 PDB entries) |
![]() | Domain d4gypb1: 4gyp B:4-137 [222276] Other proteins in same PDB: d4gypa2, d4gypb2, d4gypc1, d4gypc2, d4gypd1, d4gypd2 automated match to d1ec7d2 complexed with cit, gol, mg, p6g, peg, so4 |
PDB Entry: 4gyp (more details), 2.1 Å
SCOPe Domain Sequences for d4gypb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gypb1 d.54.1.1 (B:4-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl lgqhlgvnvasllg
Timeline for d4gypb1: