SCOPe 2.03: Domain d4gypa1: 4gyp A:3-137

Lineage for d4gypa1 (4gyp A:3-137)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein D-glucarate dehydratase [54831] (2 species)

7. Species Escherichia coli [TaxId:562] [54833] (7 PDB entries)

8. Domain d4gypa1: 4gyp A:3-137 [222274]
   Other proteins in same PDB: d4gypa2, d4gypb2
   automated match to d1ec9d2
   complexed with cit, gol, mg, p6g, peg, so4

Details for d4gypa1

PDB Entry: 4gyp, 2.1 Å

PDB Description: crystal structure of the heterotetrameric complex of glucd and glucdrp from e. coli k-12 mg1655 (efi target efi-506058)

PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d4gypa1:

Sequence; same for both SEQRES and ATOM records:

>d4gypa1 d.54.1.1 (A:3-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
sqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekir
ktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamld
llgqhlgvnvasllg

Timeline for d4gypa1:

• d4gypa1 is new in SCOPe 2.03-stable
  
• d4gypa1 appears in SCOPe 2.04
  
• d4gypa1 appears in the current release, SCOPe 2.08