![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (47 species) not a true protein |
![]() | Species Streptococcus mitis [TaxId:28037] [189586] (6 PDB entries) |
![]() | Domain d4gwia_: 4gwi A: [222253] automated match to d4gwja_ complexed with bdz, ca, gol, mg; mutant |
PDB Entry: 4gwi (more details), 1.6 Å
SCOPe Domain Sequences for d4gwia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gwia_ b.18.1.0 (A:) automated matches {Streptococcus mitis [TaxId: 28037]} nrpveteniargkqasqsstahggaatravdgnvdsdyghhsvthtnfednawwqvdlgk tenvgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftakdar yvkvelktkntplslaevevfrsa
Timeline for d4gwia_: