Lineage for d1sxab_ (1sxa B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55083Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 55084Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 55097Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 55117Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries)
  8. 55131Domain d1sxab_: 1sxa B: [22224]

Details for d1sxab_

PDB Entry: 1sxa (more details), 1.9 Å

PDB Description: crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution

SCOP Domain Sequences for d1sxab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxab_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOP Domain Coordinates for d1sxab_:

Click to download the PDB-style file with coordinates for d1sxab_.
(The format of our PDB-style files is described here.)

Timeline for d1sxab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sxaa_