Lineage for d1sxab_ (1sxa B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) 
Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries) 
Domain d1sxab_: 1sxa B: [22224]
Details for d1sxab_
PDB Entry: 1sxa (more details), 1.9 Å
PDB Description: crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution
SCOP Domain Sequences for d1sxab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxab_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak
SCOP Domain Coordinates for d1sxab_:
Click to download the PDB-style file with coordinates for d1sxab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sxab_:
- d1sxab_ appears in SCOP 1.57
- d1sxab_ appears in the current release, SCOPe 2.08
View in 3D
