Lineage for d4gwca_ (4gwc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2873863Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2874143Protein automated matches [190112] (5 species)
    not a true protein
  7. 2874158Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries)
  8. 2874172Domain d4gwca_: 4gwc A: [222231]
    automated match to d2aeba_
    complexed with mn, zn

Details for d4gwca_

PDB Entry: 4gwc (more details), 1.9 Å

PDB Description: Crystal Structure of Mn2+2,Zn2+-Human Arginase I
PDB Compounds: (A:) Arginase-1

SCOPe Domain Sequences for d4gwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gwca_ c.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
glaregnhkpidy

SCOPe Domain Coordinates for d4gwca_:

Click to download the PDB-style file with coordinates for d4gwca_.
(The format of our PDB-style files is described here.)

Timeline for d4gwca_: