SCOP 1.57: Domain d1sxaa_: 1sxa A:

Lineage for d1sxaa_ (1sxa A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries)

8. Domain d1sxaa_: 1sxa A: [22223]

Details for d1sxaa_

PDB Entry: 1sxa, 1.9 Å

PDB Description: crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution

SCOP Domain Sequences for d1sxaa_:

Sequence; same for both SEQRES and ATOM records:

>d1sxaa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d1sxaa_:

• d1sxaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1sxaa_ appears in SCOP 1.59
  
• d1sxaa_ appears in the current release, SCOPe 2.08