SCOPe 2.06: Domain d4gw4l2: 4gw4 L:97-198

Lineage for d4gw4l2 (4gw4 L:97-198)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4gw4l2: 4gw4 L:97-198 [222228]
   Other proteins in same PDB: d4gw4b1, d4gw4l1
   automated match to d1rhha2
   complexed with nag; mutant

Details for d4gw4l2

PDB Entry: 4gw4, 2.65 Å

PDB Description: crystal structure of 3bnc60 fab with p61a mutation

PDB Compounds: (L:) 3BNC60 Fab Light-chain

SCOPe Domain Sequences for d4gw4l2:

Sequence; same for both SEQRES and ATOM records:

>d4gw4l2 b.1.1.2 (L:97-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksf

Timeline for d4gw4l2:

• d4gw4l2 first appeared in SCOPe 2.03
  
• d4gw4l2 appears in SCOPe 2.05
  
• d4gw4l2 appears in SCOPe 2.07
  
• d4gw4l2 appears in the current release, SCOPe 2.08