SCOPe 2.04: Domain d4gvya2: 4gvy A:96-357

Lineage for d4gvya2 (4gvy A:96-357)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
   automatically mapped to Pfam PF00217

6. Protein Arginine kinase, C-terminal domain [55942] (2 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (11 PDB entries)
   Uniprot P51541

8. Domain d4gvya2: 4gvy A:96-357 [222218]
   Other proteins in same PDB: d4gvya1
   automated match to d1m15a2
   complexed with adp, cir, mg

Details for d4gvya2

PDB Entry: 4gvy, 2.09 Å

PDB Description: Crystal structure of arginine kinase in complex with L-citrulline and MgADP

PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d4gvya2:

Sequence; same for both SEQRES and ATOM records:

>d4gvya2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

Timeline for d4gvya2:

• d4gvya2 first appeared in SCOPe 2.03
  
• d4gvya2 appears in SCOPe 2.05
  
• d4gvya2 appears in the current release, SCOPe 2.08