Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Burkholderia multivorans [TaxId:395019] [226459] (7 PDB entries) |
Domain d4gvxb_: 4gvx B: [222214] automated match to d1gcoa_ complexed with cl, edo, ful, mg, nap |
PDB Entry: 4gvx (more details), 1.5 Å
SCOPe Domain Sequences for d4gvxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gvxb_ c.2.1.0 (B:) automated matches {Burkholderia multivorans [TaxId: 395019]} mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna vipaevmtplyrnwiatfedpeaklaeiaakvplgrrfttpdeiadtavfllsprashtt gewlfvdggythldralv
Timeline for d4gvxb_: