SCOPe 2.06: Domain d4gvxa_: 4gvx A:

Lineage for d4gvxa_ (4gvx A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Burkholderia multivorans [TaxId:395019] [226459] (5 PDB entries)

8. Domain d4gvxa_: 4gvx A: [222213]
   automated match to d1gcoa_
   complexed with cl, edo, ful, mg, nap

Details for d4gvxa_

PDB Entry: 4gvx, 1.5 Å

PDB Description: crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, with bound nadp and l-fucose

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d4gvxa_:

Sequence; same for both SEQRES and ATOM records:

>d4gvxa_ c.2.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 395019]}
mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl
pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam
ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna
vipaevmtplyrnwiatfedpeaklaeiaakvplgrrfttpdeiadtavfllsprashtt
gewlfvdggythldralv

Timeline for d4gvxa_:

• d4gvxa_ first appeared in SCOPe 2.03
  
• d4gvxa_ appears in SCOPe 2.05
  
• d4gvxa_ appears in SCOPe 2.07
  
• d4gvxa_ appears in the current release, SCOPe 2.08