Lineage for d1e9qb_ (1e9q B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 936747Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 936787Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)
  8. 936799Domain d1e9qb_: 1e9q B: [22218]
    complexed with cu, zn

Details for d1e9qb_

PDB Entry: 1e9q (more details), 1.75 Å

PDB Description: crystal structure of bovine cu zn sod - (1 of 3)
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1e9qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9qb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdderhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneeststgnagsrlacgvigiak

SCOPe Domain Coordinates for d1e9qb_:

Click to download the PDB-style file with coordinates for d1e9qb_.
(The format of our PDB-style files is described here.)

Timeline for d1e9qb_: