Lineage for d4gt0a1 (4gt0 A:2-297)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252195Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2252196Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2252241Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2252242Protein automated matches [227047] (6 species)
    not a true protein
  7. 2252246Species Dengue virus 1 [TaxId:11059] [226543] (2 PDB entries)
  8. 2252249Domain d4gt0a1: 4gt0 A:2-297 [222131]
    Other proteins in same PDB: d4gt0a2, d4gt0b2
    automated match to d1urza2
    complexed with cd, cl, nag

Details for d4gt0a1

PDB Entry: 4gt0 (more details), 2.57 Å

PDB Description: structure of dengue virus serotype 1 se containing stem to residue 421
PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d4gt0a1:

Sequence, based on SEQRES records: (download)

>d4gt0a1 f.10.1.0 (A:2-297) automated matches {Dengue virus 1 [TaxId: 11059]}
rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci
eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrghgngcglfgkgslitcakfkc
vtklegkivqyenlkysvivtvhtgdqhqvgnettehgtiatitpqaptseiqltdygal
tldcsprtgldfnemvlltmkekswlvhkqwfldlplpwtsgastsqetwnrqdllvtfk
tahakkqevvvlgsqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgm

Sequence, based on observed residues (ATOM records): (download)

>d4gt0a1 f.10.1.0 (A:2-297) automated matches {Dengue virus 1 [TaxId: 11059]}
rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci
eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrghgngcglfgkgslitcakfkc
vtklegkivqyenlkysvivtvhtggtiatitpqaptseiqltdygaltldcsprtgldf
nemvlltmkekswlvhkqwfldlplpwtsgastsqetwnrqdllvtfktahakkqevvvl
gsqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgm

SCOPe Domain Coordinates for d4gt0a1:

Click to download the PDB-style file with coordinates for d4gt0a1.
(The format of our PDB-style files is described here.)

Timeline for d4gt0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gt0a2