SCOPe 2.03: Domain d4gsdl1: 4gsd L:5-108

Lineage for d4gsdl1 (4gsd L:5-108)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4gsdl1: 4gsd L:5-108 [222119]
   Other proteins in same PDB: d4gsdl2
   automated match to d1adql1

Details for d4gsdl1

PDB Entry: 4gsd, 2.25 Å

PDB Description: h5.3 fab structure

PDB Compounds: (L:) H5.3 Fab Light Chain

SCOPe Domain Sequences for d4gsdl1:

Sequence; same for both SEQRES and ATOM records:

>d4gsdl1 b.1.1.0 (L:5-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltqppsvsvspgqtvnitcsgdtlgdkyvcwyqqkpgqspvlviyqdtkrpsgiperfsg
snsgdtatltvsgtqamdeadyycqawdsssfvfgtgtkvtvlr

Timeline for d4gsdl1:

• d4gsdl1 is new in SCOPe 2.03-stable
  
• d4gsdl1 appears in SCOPe 2.04
  
• d4gsdl1 appears in the current release, SCOPe 2.08