Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d4grmd1: 4grm D:1-117 [222110] Other proteins in same PDB: d4grma1, d4grma2, d4grmb2, d4grmc1, d4grmc2, d4grmd2 automated match to d1ktke1 |
PDB Entry: 4grm (more details), 2 Å
SCOPe Domain Sequences for d4grmd1:
Sequence, based on SEQRES records: (download)
>d4grmd1 b.1.1.0 (D:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]} nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev pngynvsrsttedfplrllsaapsqtsvyfcasrpglmsaqpeqyfgpgtrltvte
>d4grmd1 b.1.1.0 (D:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]} nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev pngynvsrsttedfplrllsaapsqtsvyfcasrpgmsaqpeqyfgpgtrltvte
Timeline for d4grmd1: