SCOPe 2.03: Domain d4grmd1: 4grm D:1-117

Lineage for d4grmd1 (4grm D:1-117)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4grmd1: 4grm D:1-117 [222110]
   Other proteins in same PDB: d4grma1, d4grma2, d4grmb2, d4grmc1, d4grmc2, d4grmd2
   automated match to d1ktke1

Details for d4grmd1

PDB Entry: 4grm, 2 Å

PDB Description: the crystal structure of the high affinity tcr a6

PDB Compounds: (D:) A6 beta chain

SCOPe Domain Sequences for d4grmd1:

Sequence, based on SEQRES records:

>d4grmd1 b.1.1.0 (D:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpglmsaqpeqyfgpgtrltvte

Sequence, based on observed residues (ATOM records):

>d4grmd1 b.1.1.0 (D:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
pngynvsrsttedfplrllsaapsqtsvyfcasrpgmsaqpeqyfgpgtrltvte

Timeline for d4grmd1:

• d4grmd1 is new in SCOPe 2.03-stable
  
• d4grmd1 appears in SCOPe 2.04
  
• d4grmd1 appears in the current release, SCOPe 2.08