Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (13 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [224917] (1 PDB entry) |
Domain d4gqua1: 4gqu A:10-95 [222094] automated match to d2f1da1 complexed with edo, mn |
PDB Entry: 4gqu (more details), 2.02 Å
SCOPe Domain Sequences for d4gqua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gqua1 d.14.1.0 (A:10-95) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} srrarierrtresdivieldldgtgqvavdtgvpfydhmltalgshasfdltvratgdve ieahhtiedtaialgtalgqalgdkr
Timeline for d4gqua1: