Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) automatically mapped to Pfam PF08113 |
Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins) |
Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species) functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II |
Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries) |
Domain d4gp8c_: 4gp8 C: [222072] Other proteins in same PDB: d4gp8a_, d4gp8b1, d4gp8b2 automated match to d1xmec_ complexed with cu, cua, has, hem, olc, per; mutant |
PDB Entry: 4gp8 (more details), 2.8 Å
SCOPe Domain Sequences for d4gp8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gp8c_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]} kpkgalavilvltltilvfwlgvyavffarg
Timeline for d4gp8c_: